Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Spicy Chicken Mee Goreng

Quick stir-fried noodles tossed with shredded chicken, sweet chili, and tamarind in a blazing wok. Mamak-style heat and sticky-savory glaze in under 20 minutes.

Total time
20 min
Servings
2
Calories
520
Protein
36g
20-Min Spicy Chicken Mee Goreng
boldsatisfyingmalaysianchickenchewycrispyweeknightnoodles

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil noodles in salted water until al dente, about 4 minutes. Drain and set aside.

  2. Step 2

    Whisk together sweet chili sauce, tamarind paste, and broth in a bowl until smooth.

  3. Step 3

    Heat oil in a large wok or skillet over high heat until shimmering, about 90 seconds.

  4. Step 4

    Add diced red onion and cook, stirring, until just softened and fragrant, 90 seconds.

  5. Step 5

    Add chicken and noodles, pour sauce over, and toss hard for 2 minutes until noodles are coated and sauce caramelizes slightly.

  6. Step 6

    Squeeze lime juice over the top, garnish with fresh chili or chili flakes, and serve hot.

Tools you’ll need

  • large wok or 12-inch skillet
  • pot for boiling
  • small mixing bowl
  • tongs or wooden spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.