Custrd is out on the App Store — Download it free →
Back to recipes

Malaysian Nasi Biryani with Mixed Protein

Fragrant one-pot rice with chicken, shrimp, and aromatic spices. A simplified Malaysian biryani that delivers authentic flavor in under 45 minutes.

Total time
40 min
Servings
2
Calories
542
Protein
28g
Malaysian Nasi Biryani with Mixed Protein
comfortsatisfyingmalaysianchickenshrimpfluffytenderweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cut the chicken thighs into 1-inch cubes by placing each thigh on a cutting board and slicing lengthwise into three strips, then cutting crosswise into 1-inch pieces.

  2. Step 2

    Slice the onion in half from root to tip, then place each half flat-side down and slice crosswise into thin half-moon slices about 1/8-inch thick.

  3. Step 3

    Rinse the rice in a fine-mesh strainer under cold running water, stirring gently with your fingers for 30 seconds until the water runs mostly clear, then shake the strainer dry.

  4. Step 4

    Heat the ghee in a large heavy-bottomed pot over medium heat for 30 seconds until it melts and becomes liquid.

  5. Step 5

    Add the onion slices to the ghee and stir once every 15 seconds for 4 minutes until they turn golden brown and smell sweet and caramelized.

  6. Step 6

    Scatter the biryani spices over the onions and stir for 20 seconds until they smell strongly fragrant, coating everything with the oils.

  7. Step 7

    Add the chicken pieces to the pot and stir every 15 seconds for 2 minutes until the outside turns opaque (no longer pink), then add the shrimp and stir for 30 seconds until they turn pink.

  8. Step 8

    Pour in 2.5 cups water and stir once to combine, then add the rinsed rice and stir gently until all grains are submerged in liquid.

  9. Step 9

    Increase heat to medium-high and bring the pot to a boil — you'll see large bubbles breaking the surface — about 2 minutes.

  10. Step 10

    Reduce heat to low, place a piece of parchment paper directly over the rice surface, then cover the pot with a tight-fitting lid to trap steam.

  11. Step 11

    Cook on low heat for 20 minutes without lifting the lid; the rice and protein will absorb all the liquid.

  12. Step 12

    Remove the pot from heat, keep the lid and parchment on, and let it rest for 5 minutes so any remaining moisture steams the grains evenly.

  13. Step 13

    Remove the lid and parchment paper carefully, then gently fluff the rice with a fork, lifting from the bottom to separate clumps.

  14. Step 14

    Divide the biryani between two bowls and serve hot.

Tools you’ll need

  • fine-mesh strainer
  • cutting board
  • chef's knife
  • large heavy-bottomed pot with tight-fitting lid (3-quart minimum)
  • wooden spoon
  • fork
  • parchment paper

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.