Custrd is out on the App Store — Download it free →
Back to recipes

Mangalorean Fish Curry with Rice

A tangy, spicy coconut fish curry from the coastal Karnataka region, served over steamed rice. This weeknight-friendly version uses common ingredients and comes together in about 40 minutes.

Total time
40 min
Servings
4
Calories
450
Protein
30g
Mangalorean Fish Curry with Rice
comfortingIndiangluten-freefishcreamytenderweeknightcurry

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Rinse the 1 cup rice and cook with 2 cups water in a pot or rice cooker until tender, about 15-20 minutes. Keep warm.

  2. Step 2

    Slice the 1 onion and slit the 2 green chilies lengthwise. Pat the 1 lb fish dry and cut into 2-inch chunks.

  3. Step 3

    In a deep pan, heat 1 tbsp oil over medium. Add the sliced onion and green chilies, sauté until onion is soft and translucent, about 5 minutes.

  4. Step 4

    Add 1 tsp turmeric, 1 tbsp tamarind paste, and 1 tsp salt. Stir for 1 minute until fragrant.

  5. Step 5

    Pour in the 1 can coconut milk and bring to a gentle simmer. Cook for 5 minutes, stirring occasionally, until slightly thickened.

  6. Step 6

    Add the fish chunks in a single layer. Simmer gently, spooning sauce over fish, until fish is opaque and flakes easily, about 8-10 minutes.

  7. Step 7

    Serve the curry hot over the cooked rice.

Tools you’ll need

  • pot for rice
  • deep pan or skillet
  • knife
  • cutting board
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.