Custrd is out on the App Store — Download it free →
Back to recipes

Yogurt-Based Lotus Root Curry

A quick and creamy curry featuring lotus root simmered in a spiced yogurt sauce, finished with fresh cilantro and red chili. Perfect for a weeknight dinner.

Total time
20 min
Servings
2
Calories
220
Protein
8g
Yogurt-Based Lotus Root Curry
comfortingIndianvegetariangluten-freedairycreamytenderweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Peel and slice the 1 lb lotus root into 1/4 inch rounds. Boil in salted water until just tender, about 10 minutes, then drain.

  2. Step 2

    In a blender, combine 1 cup yogurt, 1 chopped tomato, 1 chopped onion, and 1 tsp ground cumin. Blend until smooth.

  3. Step 3

    Pour the yogurt mixture into a skillet over medium heat. Stir constantly until it thickens and turns a shade darker, about 5 minutes.

  4. Step 4

    Add the boiled lotus root to the sauce. Simmer for 5 minutes, stirring occasionally, until the sauce coats the slices and everything is heated through.

  5. Step 5

    Season with salt to taste. Garnish with 1/4 cup chopped cilantro and sliced red chili if desired. Serve hot.

Tools you’ll need

  • skillet
  • blender
  • pot

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.