Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Pan-Seared Beef with Horseradish & Garlic

Quick German-inspired beef with crispy garlic cloves and tangy horseradish cream. A TikTok-easy weeknight dinner that tastes like a proper roast in under 20 minutes.

Total time
18 min
Servings
2
Calories
520
Protein
48g
Pan-Seared Beef with Horseradish & Garlic
satisfyingrusticgermanbeefcrispytendercreamyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat beef steaks dry with paper towels. Season generously with salt and pepper on both sides.

  2. Step 2

    Heat 1 tbsp butter in a 12-inch skillet over medium-high until it foams. Sear steaks 2 minutes per side without moving — surface should be golden brown.

  3. Step 3

    Push steaks to the side. Add garlic cloves and remaining 1 tbsp butter to the pan. Toss garlic until golden and fragrant, about 3 minutes.

  4. Step 4

    Pour beef broth into the pan. Reduce heat to medium, cover, and cook 5 minutes until steaks reach 130°F (medium-rare) on an instant-read thermometer.

  5. Step 5

    Stir horseradish sauce into sour cream in a small bowl until smooth.

  6. Step 6

    Transfer steaks and roasted garlic to plates. Serve with horseradish cream on the side.

Tools you’ll need

  • 12-inch cast iron or stainless steel skillet
  • instant-read thermometer
  • small mixing bowl
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.