Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Pesto Grilled Cheese

Crispy buttered bread wrapped around melted cheese and vibrant pesto. Ready in 10 minutes—perfect for lunch or a quick dinner.

Total time
10 min
Servings
2
Calories
385
Protein
14g
Pesto Grilled Cheese
comfortquickamericanvegetariancrispymeltyweeknightlunch

Ingredients

5 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Spread 0.5 tablespoon butter on one side of each bread slice.

  2. Step 2

    Place a bread slice butter-side down in a skillet over medium heat.

  3. Step 3

    Spread 1.5 tablespoons pesto on the unbuttered side of the bread in the pan.

  4. Step 4

    Layer 2 cheese slices over the pesto.

  5. Step 5

    Top with a second bread slice, butter-side up.

  6. Step 6

    Cook until golden brown and crispy, ~3–4 minutes. Do not move.

  7. Step 7

    Flip carefully and cook the other side until golden and cheese melts, ~2–3 minutes.

  8. Step 8

    Transfer to a cutting board. Repeat with remaining bread, pesto, and cheese.

  9. Step 9

    Serve hot.

Tools you’ll need

  • 12-inch nonstick or cast-iron skillet
  • butter knife
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.