Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Mozzarella Tomato Panini

A warm, melty press of fresh mozzarella, ripe tomato, and basil pesto on crusty bread—ready in 10 minutes. Toast it in a skillet until the bread is golden and the cheese flows.

Total time
10 min
Servings
2
Calories
385
Protein
14g
Crispy Mozzarella Tomato Panini
casualquickamericanvegetariancheesecrispymeltyweeknight

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Spread 1 tbsp pesto on one bread slice, then layer half the mozzarella and tomato on top.

  2. Step 2

    Top with a second bread slice, pesto side down, pressing gently.

  3. Step 3

    Repeat with remaining bread, pesto, mozzarella, and tomato to make a second sandwich.

  4. Step 4

    Heat a skillet over medium-high until a water drop sizzles on contact.

  5. Step 5

    Place sandwiches in the skillet and press gently with a spatula 3–4 minutes until bread turns golden.

  6. Step 6

    Flip and toast the other side 2–3 minutes until cheese melts and bread crisps.

Tools you’ll need

  • chef's knife
  • cutting board
  • 12-inch skillet
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.