Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Caprese Panini

Crusty bread stuffed with fresh mozzarella, tomato, and pesto, then pressed until golden and melty. A warm, gooey sandwich that tastes like summer in under 10 minutes.

Total time
10 min
Servings
2
Calories
520
Protein
18g
Crispy Caprese Panini
casualquickamericanvegetariancrispymeltyweeknightlunch

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Slice the bread in half lengthwise and spread pesto on both cut sides.

  2. Step 2

    Layer mozzarella slices and tomato slices on the bottom half, then press the top half down.

  3. Step 3

    Heat a skillet over medium-high until shimmering, then place the sandwich inside.

  4. Step 4

    Press down with a spatula for 2–3 minutes until the bottom is golden and crispy.

  5. Step 5

    Flip and press the other side for 2–3 minutes until golden and the cheese melts.

  6. Step 6

    Transfer to a cutting board, slice diagonally, and serve hot.

Tools you’ll need

  • chef's knife
  • cutting board
  • 12-inch skillet
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.