CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Caprese Panini

Crusty bread stuffed with fresh mozzarella, tomato, and pesto, then pressed until golden and melty. A warm, gooey sandwich that tastes like summer in under 10 minutes.

Total time
10 min
Servings
2
Calories
520
Protein
18g
Crispy Caprese Panini
casualquickamericanvegetariancrispymeltyweeknightlunch

Ingredients

  • 1 loaf (8 oz) bread (ciabatta or focaccia)
  • 8 oz fresh mozzarella
  • 2 medium tomato
  • ¼ cup pesto

Instructions

  1. 1

    Slice the bread in half lengthwise and spread pesto on both cut sides.

  2. 2

    Layer mozzarella slices and tomato slices on the bottom half, then press the top half down.

  3. 3

    Heat a skillet over medium-high until shimmering, then place the sandwich inside.

  4. 4

    Press down with a spatula for 2–3 minutes until the bottom is golden and crispy.

  5. 5

    Flip and press the other side for 2–3 minutes until golden and the cheese melts.

  6. 6

    Transfer to a cutting board, slice diagonally, and serve hot.

Tools you’ll need

  • chef's knife
  • cutting board
  • 12-inch skillet
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.