Custrd is out on the App Store — Download it free →
Back to recipes

Roast Chicken with Mushrooms

Juicy roasted chicken thighs nestled in a creamy mushroom sauce, served with crispy fries. A comforting weeknight dinner that comes together in about 40 minutes.

Total time
40 min
Servings
4
Calories
650
Protein
35g
Roast Chicken with Mushrooms
comfortingamericangluten-freechickencrispytenderweeknightmain course

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 425°F. Spread the 12 oz frozen fries on a baking sheet and bake until golden and crispy, about 25 minutes, shaking halfway.

  2. Step 2

    Pat the 4 chicken thighs dry and season both sides with the 1 tsp salt and 0.5 tsp pepper.

  3. Step 3

    Heat the 2 tbsp olive oil in a large oven-safe skillet over medium-high. Place chicken skin-side down and cook until golden brown, about 5 minutes. Flip and cook 3 more minutes. Remove chicken to a plate.

  4. Step 4

    Add the 8 oz sliced mushrooms and 2 minced garlic cloves to the skillet. Cook, stirring, until mushrooms release their liquid and start to brown, about 5 minutes.

  5. Step 5

    Pour in the 1 cup heavy cream and scrape up any browned bits. Bring to a simmer, then return chicken to the skillet, skin-side up.

  6. Step 6

    Transfer skillet to oven and roast until chicken is cooked through (165°F) and sauce thickens slightly, about 15 minutes.

  7. Step 7

    Serve chicken and mushrooms with the crispy fries on the side.

Tools you’ll need

  • baking sheet
  • large oven-safe skillet
  • tongs
  • knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.