Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Roti Canai with Dhal Curry

Crispy, flaky Malaysian flatbread made by stretching and folding dough, paired with a silky yellow lentil curry for dipping. A vegetarian breakfast showstopper that looks impressive but requires only basic pantry staples.

Total time
45 min
Servings
2
Calories
580
Protein
16g
Roti Canai with Dhal Curry
comfortrusticmalaysianvegetarianvegetariancrispyflakytender

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix flour and salt in a bowl. Pour in water gradually, stirring until a shaggy dough forms.

  2. Step 2

    Knead dough on a lightly oiled counter for 5 minutes until smooth and slightly tacky.

  3. Step 3

    Divide dough into 4 equal balls. Cover with plastic wrap and rest 15 minutes.

  4. Step 4

    Rinse lentils. Boil in 2 cups salted water until completely soft, about 20 minutes.

  5. Step 5

    In a small skillet, heat 1 tbsp butter over medium. Sauté garlic and diced onion for 3 minutes until soft and fragrant.

  6. Step 6

    Stir turmeric into the garlic mixture. Cook 30 seconds until bloomed, then add cooked lentils.

  7. Step 7

    Simmer dhal for 5 minutes, stirring occasionally. Add salt and pepper to taste. Keep warm.

  8. Step 8

    Oil a work surface lightly. Flatten one dough ball into a thin 6-inch square with your hands.

  9. Step 9

    Drizzle 0.5 tsp melted butter over the dough, then fold into quarters like an envelope. Flatten gently.

  10. Step 10

    Heat a 10-inch skillet over medium-high until very hot, ~2 minutes. Lightly oil the surface.

  11. Step 11

    Place roti in the hot skillet. Cook 2 minutes until the bottom is light golden and puffed in spots.

  12. Step 12

    Flip and cook the other side 90 seconds until edges are golden brown and surface is crispy.

  13. Step 13

    Transfer to a plate. Repeat with remaining dough balls.

  14. Step 14

    Tear roti into pieces. Serve alongside warm dhal for dipping.

Tools you’ll need

  • large mixing bowl
  • 10-inch skillet
  • small skillet
  • 3-quart saucepan
  • wooden spoon
  • plastic wrap

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.