Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Sate Lilit — Crispy Fish Satay with Sambal

Minced fish mixed with coconut and spices, wrapped around skewers and pan-fried until golden. Served with chicken satay, sambal matah, sambal ulek, and plecing kangkung for a complete Balinese spread.

Total time
25 min
Servings
2
Calories
285
Protein
28g
Sate Lilit — Crispy Fish Satay with Sambal
satisfyingrusticindonesianfishcrispytenderweeknightdinner

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Soak 8 wooden skewers in water for 10 minutes while you prep.

  2. Step 2

    Combine minced fish, coconut, shallots, garlic, ginger, lime zest, and juice in a bowl with a big pinch of salt.

  3. Step 3

    Knead the mixture with your hands until it holds together, then mold around the soaked skewers in a thin, flat spiral.

  4. Step 4

    Heat oil in a large skillet over medium-high until it shimmers, about 90 seconds.

  5. Step 5

    Pan-fry the sate 2–3 minutes per side until edges are golden-brown and the surface looks set.

  6. Step 6

    Serve hot with sambal matah, sambal ulek, plecing kangkung, and grilled chicken sate on the side.

Tools you’ll need

  • 8 wooden skewers
  • large skillet or frying pan (10-inch minimum)
  • mixing bowl
  • microplane or fine grater

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.