Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

15-Minute Sesame Fried Rice

Cooked rice hits a hot skillet with frozen vegetables, soy sauce, and sesame seeds for a nutty, crispy-edged fried rice in under 15 minutes. High heat is the secret—it keeps the rice fluffy and gives the pan that essential sizzle.

Total time
15 min
Servings
2
Calories
285
Protein
6g
15-Minute Sesame Fried Rice
quicksimpleasianvegetarianvegandairy-freecrispyfluffy

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 2 tbsp oil in a large skillet over medium-high heat until it shimmers, about 90 seconds.

  2. Step 2

    Add frozen vegetables and stir-fry for 3 minutes until edges start to brown and they're no longer icy.

  3. Step 3

    Push vegetables to the side. Add rice to the empty space and let it sit without stirring for 2 minutes—this creates crispy edges.

  4. Step 4

    Break up the rice with a spatula and toss everything together over the heat for 2 minutes until the pan sizzles loudly.

  5. Step 5

    Pour soy sauce around the pan and toss until every grain is coated and darkened, about 1 minute.

  6. Step 6

    Remove from heat. Stir in sesame seeds and serve immediately.

Tools you’ll need

  • 12-inch skillet or wok
  • spatula or wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.