CookSnap is in beta — Get it free on TestFlight →
Back to recipes

15-Minute Sesame Fried Rice

Cooked rice hits a hot skillet with frozen vegetables, soy sauce, and sesame seeds for a nutty, crispy-edged fried rice in under 15 minutes. High heat is the secret—it keeps the rice fluffy and gives the pan that essential sizzle.

Total time
15 min
Servings
2
Calories
285
Protein
6g
15-Minute Sesame Fried Rice
quicksimpleasianvegetarianvegandairy-freecrispyfluffy

Ingredients

  • 2 cups cooked rice (day-old or cooled)
  • 1.5 cups frozen mixed vegetables
  • 2 tbsp soy sauce
  • 2 tbsp sesame seeds

Instructions

  1. 1

    Heat 2 tbsp oil in a large skillet over medium-high heat until it shimmers, about 90 seconds.

  2. 2

    Add frozen vegetables and stir-fry for 3 minutes until edges start to brown and they're no longer icy.

  3. 3

    Push vegetables to the side. Add rice to the empty space and let it sit without stirring for 2 minutes—this creates crispy edges.

  4. 4

    Break up the rice with a spatula and toss everything together over the heat for 2 minutes until the pan sizzles loudly.

  5. 5

    Pour soy sauce around the pan and toss until every grain is coated and darkened, about 1 minute.

  6. 6

    Remove from heat. Stir in sesame seeds and serve immediately.

Tools you’ll need

  • 12-inch skillet or wok
  • spatula or wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.