Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Sheet-Pan Burek with Spinach & Feta

Crispy phyllo-wrapped spinach, feta, and ground lamb baked until golden in under 20 minutes. A TikTok-easy Balkan classic that feels fancy but requires zero rolling skill.

Total time
18 min
Servings
4
Calories
312
Protein
11g
Sheet-Pan Burek with Spinach & Feta
elegantcomfortbalkanvegetarianeggscheesecrispycreamy

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 2 tbsp olive oil in a skillet over medium. Sauté diced onion until softened, ~3 minutes.

  2. Step 2

    Add spinach and cook until wilted and any liquid evaporates, ~2 minutes. Transfer to a bowl.

  3. Step 3

    Stir feta, eggs, lemon zest, and lemon juice into the spinach mixture. Season with salt and pepper.

  4. Step 4

    Brush a sheet pan with 1 tbsp olive oil. Layer 4 phyllo sheets on top, brushing each with oil.

  5. Step 5

    Spread spinach-feta filling evenly over phyllo. Top with remaining 4 phyllo sheets, brushing each with oil.

  6. Step 6

    Score the top into 8 portions with a knife. Bake at 400°F until golden brown, ~8 minutes.

Tools you’ll need

  • 12-inch skillet
  • sheet pan
  • brush (pastry or silicone)
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.