Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Feta Phyllo Pie (20 Minutes)

Buttery phyllo sheets stuffed with creamy feta, dill, and egg — baked until golden and shatteringly crispy. A Greek-style cheese pie that feels fancy but takes 15 minutes flat.

Total time
20 min
Servings
4
Calories
385
Protein
12g
Crispy Feta Phyllo Pie (20 Minutes)
elegantcasualgreekvegetariancheeseeggscrispycreamy

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 400°F. Mix feta, eggs, dill, and minced onion in a bowl until combined.

  2. Step 2

    Lay one phyllo sheet on a work surface. Brush lightly with melted butter.

  3. Step 3

    Layer and butter 3 more sheets on top, brushing each lightly between layers.

  4. Step 4

    Spread half the feta filling in a line across the bottom third of the phyllo stack.

  5. Step 5

    Roll up tightly from the bottom. Transfer seam-side down to a buttered baking sheet.

  6. Step 6

    Repeat with remaining 4 phyllo sheets and filling to make a second roll.

  7. Step 7

    Brush both rolls with remaining butter. Bake until golden brown, 12–14 minutes.

  8. Step 8

    Cool 2 minutes. Slice into 2-inch pieces. Serve warm.

Tools you’ll need

  • oven
  • large mixing bowl
  • pastry brush
  • baking sheet
  • serrated knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.