Back to recipes
Sheet Pan Garlic Shrimp & Broccoli
Garlicky shrimp and crispy broccoli roasted together on one pan in under 20 minutes. Serve over rice with the charred bits and juices pooled on top.
- Total time
- 18 min
- Servings
- 2
- Calories
- 242
- Protein
- 28g
quicksimpleamericanshrimpcrispytenderweeknightsheet-pan
Ingredients
5 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Preheat oven to 425°F and line a sheet pan with foil or parchment.
Step 2
Toss shrimp and broccoli with olive oil, minced garlic, salt, and pepper on the sheet pan.
Step 3
Spread in a single layer and roast for 12–14 minutes until shrimp are pink and broccoli edges char.
Step 4
Serve hot over steamed white rice, topped with pan juices and charred bits.
Tools you’ll need
- sheet pan
- foil or parchment paper
- mixing bowl
- oven
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.
