Sheet Pan Garlic Shrimp & Broccoli
Garlicky shrimp and crispy broccoli roasted together on one pan in under 20 minutes. Serve over rice with the charred bits and juices pooled on top.
- Total time
- 18 min
- Servings
- 2
- Calories
- 242
- Protein
- 28g

quicksimpleamericanshrimpcrispytenderweeknightsheet-pan
Ingredients
- ¾ lb shrimp, peeled and deveined
- 4 cups broccoli florets
- 4 cloves garlic, minced
- 3 tbsp olive oil
- ¼ tsp salt and pepper
Instructions
- 1
Preheat oven to 425°F and line a sheet pan with foil or parchment.
- 2
Toss shrimp and broccoli with olive oil, minced garlic, salt, and pepper on the sheet pan.
- 3
Spread in a single layer and roast for 12–14 minutes until shrimp are pink and broccoli edges char.
- 4
Serve hot over steamed white rice, topped with pan juices and charred bits.
Tools you’ll need
- sheet pan
- foil or parchment paper
- mixing bowl
- oven
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



