Back to recipes
Sheet Pan Gnocchi with Mushrooms & Shallot
Tender gnocchi roasted with mushrooms and shallot on one pan—ready in under 20 minutes. Simple, savory, and completely weeknight-proof.
- Total time
- 18 min
- Servings
- 2
- Calories
- 320
- Protein
- 8g
comfortsimpleitalianvegetariantendercrispyweeknightpasta
Ingredients
4 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Preheat oven to 425°F and line a sheet pan with parchment.
Step 2
Toss gnocchi, mushrooms, and shallot with olive oil, salt, and pepper on the sheet pan.
Step 3
Spread in a single layer and roast until mushroom edges brown and gnocchi is golden, ~12 minutes.
Step 4
Remove from oven and taste—adjust salt and pepper as needed.
Step 5
Serve hot straight from the pan.
Tools you’ll need
- sheet pan
- parchment paper
- oven
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.
