Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Solterito Arequipeño

A vibrant Peruvian corn and cheese salad from Arequipa, combining charred corn, creamy cheese, and a bright lime-cilantro dressing. Ready in 20 minutes with minimal prep.

Total time
20 min
Servings
4
Calories
285
Protein
9g
Solterito Arequipeño
freshlightperuvianvegetariancheesecrispycreamyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    If using fresh corn, cut the kernels off the cob by holding the cob upright on a cutting board and scraping downward with a knife, rotating as you go, until all kernels fall into a bowl.

  2. Step 2

    Heat a large skillet over medium-high heat until it is very hot and a drop of water sizzles and evaporates immediately, about 2 minutes.

  3. Step 3

    Add the corn to the dry skillet with no oil and stir frequently until kernels turn golden brown and slightly charred in spots, about 5 minutes.

  4. Step 4

    Transfer the charred corn to a large bowl and let it cool for 2 minutes until it is comfortable to touch.

  5. Step 5

    Cut the red onion in half lengthwise from root to tip, then lay each half flat and slice crosswise into thin half-rings about 1/8 inch thick.

  6. Step 6

    Add the crumbled cheese, sliced red onion, and cilantro to the cooled corn and stir gently until everything is mixed together.

  7. Step 7

    Pour the lime juice and olive oil into the salad and toss gently until all ingredients are coated evenly.

  8. Step 8

    Taste a spoonful and add salt and pepper until it tastes bright and balanced — you should taste the lime, the charred corn, and the salty cheese equally.

Tools you’ll need

  • cutting board
  • chef's knife
  • 12-inch skillet
  • wooden spoon
  • large mixing bowl
  • kitchen towel (optional, for cooling)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.