Custrd is out on the App Store — Download it free →
Back to recipes

Spiced Grilled Fish

A whole fish marinated in warm spices, grilled until charred and juicy, served with crisp onion rings, lime wedges, and two easy sauces.

Total time
35 min
Servings
2
Calories
450
Protein
35g
Spiced Grilled Fish
comfortingindiangluten freefishflakycrispyweeknightmain

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    In a small bowl, mix 1/2 cup yogurt, 2 tsp garam masala, 1 tsp paprika, and 1 tsp salt. Score the fish 3 times on each side, then rub the marinade all over, inside and out. Let sit for 15 minutes.

  2. Step 2

    Preheat grill or broiler to medium-high. Place the fish on a lightly oiled grate or baking sheet. Cook for 8-10 minutes per side, until the skin is charred and the flesh flakes easily with a fork.

  3. Step 3

    While the fish cooks, slice 1 medium onion into thin rings and soak in cold water for 5 minutes to crisp. Cut 1 lime into wedges.

  4. Step 4

    For the orange sauce, whisk 1/4 cup mayonnaise with 2 tbsp orange juice (from the lime? no, use orange juice—but we didn't list orange; adjust: use lime juice instead) — actually, we'll make a lime-mayo sauce: mix 1/4 cup mayo with juice of half the lime.

  5. Step 5

    For the white sauce, mix 1/4 cup yogurt (from the marinade? we used all; so use extra? we didn't list extra; so skip white sauce or use mayo as base) — better: use the remaining yogurt? we have none; so we'll make a simple yogurt sauce by reserving 2 tbsp of the marinade before adding to fish. So step: Reserve 2 tbsp of the marinade in a small bowl for the white sauce.

  6. Step 6

    Serve the hot fish with onion rings, lime wedges, and both sauces on the side.

  7. Step 7

    Garnish with extra lime wedges if desired.

Tools you’ll need

  • grill or broiler
  • small bowl
  • baking sheet (if broiling)
  • knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.