Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Spicy Batata Harra with Lemon & Lettuce

Crispy fried potatoes tossed with garlic, cilantro, and chili for a vibrant Middle Eastern side that's loud enough to be dinner. Served with cool lettuce and bright lemon to cut through the heat.

Total time
25 min
Servings
2
Calories
320
Protein
5g
Spicy Batata Harra with Lemon & Lettuce
comfortboldmiddle-easternvegetarianvegandairy-freecrispytender

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cut potatoes into 1-inch chunks. Heat oil in a large skillet over medium-high until it shimmers, about 60 seconds.

  2. Step 2

    Add potatoes and cook without stirring for 4 minutes until the bottom edges turn golden, then toss and cook 6–8 minutes more until crispy and cooked through.

  3. Step 3

    Push potatoes to the side, add minced garlic and chili flakes to the empty space, and cook 30 seconds until fragrant.

  4. Step 4

    Toss everything together, then fold in cilantro and a big pinch of salt off heat.

  5. Step 5

    Squeeze half the lemon over the potatoes. Serve with lettuce leaves on the side and remaining lemon wedges.

Tools you’ll need

  • large skillet (12-inch cast iron or non-stick preferred)
  • knife and cutting board
  • wooden spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.