Custrd is out on the App Store — Download it free →
Back to recipes

Spinach and Cottage Cheese Curry

A quick, creamy weeknight curry with wilted spinach and pan-seared cottage cheese cubes, finished with a touch of cream and warm spices.

Total time
20 min
Servings
2
Calories
420
Protein
22g
Spinach and Cottage Cheese Curry
comfortingIndianvegetariangluten-freecheesecreamytenderweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cut the 8 oz cottage cheese into 1-inch cubes. Heat 1 tbsp olive oil in a large skillet over medium-high heat, then sear the cubes until golden on two sides, about 4 minutes total. Remove and set aside.

  2. Step 2

    In the same skillet, add the remaining 1 tbsp olive oil and 3 minced garlic cloves. Cook over medium until fragrant, about 1 minute.

  3. Step 3

    Add the 10 oz spinach in handfuls, stirring until wilted, about 3 minutes. Stir in 0.5 tsp turmeric and 0.5 cup heavy cream, then simmer until slightly thickened, about 2 minutes.

  4. Step 4

    Return the seared cottage cheese to the skillet, stir gently to coat, and cook for 2 more minutes until heated through. Season with salt and pepper to taste.

  5. Step 5

    Serve hot, garnished with fresh cilantro if you have it.

Tools you’ll need

  • Large skillet
  • Cutting board
  • Knife
  • Wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.