Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Spinach Fatayer

Crispy, golden Lebanese spinach hand pies with a bright lemon-garlic filling. Bake or air-fry store-bought phyllo for a weeknight shortcut that tastes homemade.

Total time
20 min
Servings
4
Calories
298
Protein
11g
Spinach Fatayer
casualfreshlebanesevegetarianvegetariancrispyflakyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 2 tbsp olive oil in a large skillet over medium-high heat for 90 seconds.

  2. Step 2

    Add onion and cook for 2 minutes until softened and fragrant.

  3. Step 3

    Add spinach by handfuls, stirring, until completely wilted and any liquid cooks off, ~4 minutes.

  4. Step 4

    Stir in feta, garlic, lemon zest, and lemon juice. Season with salt and pepper. Remove from heat.

  5. Step 5

    Lay one phyllo sheet on a work surface. Brush lightly with olive oil. Fold in half lengthwise.

  6. Step 6

    Spoon 2–3 tbsp spinach filling onto one end. Fold into a triangle, tucking edges as you go. Repeat with remaining phyllo and filling.

  7. Step 7

    Arrange triangles seam-side down on a lined baking sheet. Brush tops lightly with olive oil.

  8. Step 8

    Bake at 400°F for 10–12 minutes until golden and crispy. Sprinkle pine nuts if using. Serve warm.

Tools you’ll need

  • large skillet (12-inch)
  • baking sheet
  • parchment paper
  • pastry brush
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.