Custrd is out on the App Store — Download it free →
Back to recipes

Stuffed Fish

A whole fish stuffed with a fragrant herb and breadcrumb mixture, baked until flaky and golden. Simple enough for a weeknight, impressive enough for company.

Total time
35 min
Servings
2
Calories
450
Protein
35g
Stuffed Fish
comfortingimpressivemediterraneangluten-freefishflakycrispyweeknight dinner

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 400°F (200°C). Line a baking sheet with parchment paper.

  2. Step 2

    In a small bowl, mix 1 cup breadcrumbs, 1/2 cup chopped parsley, 2 minced garlic cloves, 2 tbsp olive oil, and the zest of 1 lemon. Season with 1/2 tsp salt and 1/4 tsp pepper.

  3. Step 3

    Pat the fish dry with paper towels. Season the cavity and outside with remaining 1/2 tsp salt and 1/4 tsp pepper.

  4. Step 4

    Stuff the breadcrumb mixture into the fish cavity, packing gently. Place the fish on the prepared baking sheet.

  5. Step 5

    Drizzle the fish with remaining 1 tbsp olive oil and squeeze the juice of the lemon over the top.

  6. Step 6

    Bake for 20-25 minutes, until the fish is opaque and flakes easily with a fork. Let rest 5 minutes before serving.

  7. Step 7

    Serve the fish whole, with extra lemon wedges if desired.

Tools you’ll need

  • baking sheet
  • parchment paper
  • small bowl
  • knife
  • cutting board
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.