Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Swiss Malakoff

A classic Swiss vegetarian cake layered with almond meringue wafers and kirsch-whipped cream. Elegant, make-ahead friendly, and impressively simple to assemble.

Total time
35 min
Servings
8
Calories
285
Protein
5g
Swiss Malakoff
elegantindulgentswissvegetarianvegetariancrispycreamyfluffy

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pour the 2 cups cold heavy cream into a bowl and whisk with an electric mixer on high speed for 2–3 minutes until the cream holds soft peaks and looks thick and pillowy when you lift the whisk.

  2. Step 2

    Add the 3 tablespoons powdered sugar and the 2 tablespoons kirsch to the whipped cream, then whisk on low speed for 30 seconds until just combined and smooth.

  3. Step 3

    Place a single almond wafer on a flat plate or cake base and spread 1 tablespoon of the kirsch cream on top using a small spatula.

  4. Step 4

    Stack a second wafer on top of the cream, then spread another tablespoon of cream on that wafer.

  5. Step 5

    Repeat stacking and spreading with the remaining 22 wafers and cream, alternating wafer and cream layers, until all wafers are used and the cake is a tall vertical stack.

  6. Step 6

    Spread or gently press any remaining cream onto all four sides of the wafer stack to coat it evenly.

  7. Step 7

    Press the 0.5 cup toasted sliced almonds firmly onto all four sides of the cake so they stick to the cream.

  8. Step 8

    Use a fine-mesh sieve to dust the top of the cake evenly with the 1 tablespoon cocoa powder.

  9. Step 9

    Refrigerate the Malakoff for at least 30 minutes (or up to 8 hours) so the wafers soften slightly and the cream sets, making it easier to slice.

  10. Step 10

    Use a serrated knife dipped in hot water and wiped dry between cuts to slice the Malakoff into 8 equal portions, cutting straight down through the wafer stack.

Tools you’ll need

  • large mixing bowl
  • electric mixer (or whisk and arm strength)
  • small offset spatula or butter knife
  • flat plate or cake base
  • fine-mesh sieve
  • serrated knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.