Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Tomato & Bread Salad

Crispy bread cubes tossed with ripe tomatoes, red onion, and a bright vinaigrette—the Tuscan way to use up stale bread. Ready in 15 minutes, tastes like summer.

Total time
15 min
Servings
4
Calories
285
Protein
6g
Tomato & Bread Salad
lightfreshsimpleitalianvegetarianvegancrispytender

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cut bread into 1-inch cubes. Heat 2 tbsp olive oil in a large skillet over medium-high heat.

  2. Step 2

    Add bread cubes and cook 4–5 minutes, stirring occasionally, until golden and crispy all over.

  3. Step 3

    Transfer bread to a large bowl. Whisk together vinegar, remaining 4 tbsp oil, garlic, salt, and pepper.

  4. Step 4

    Add tomatoes, onion, and basil to the bowl with bread. Pour vinaigrette over and toss gently.

  5. Step 5

    Let sit for 5 minutes so flavors blend and bread absorbs the dressing, then taste and adjust seasoning.

  6. Step 6

    Serve at room temperature or chilled.

Tools you’ll need

  • large skillet
  • large bowl
  • whisk
  • knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.