Back to recipes
Turkey Avocado Croissant Club
Buttery croissant layered with sliced turkey, creamy avocado, crisp bacon, and fresh greens. A California-style handheld that feels fancy but takes five minutes.
- Total time
- 5 min
- Servings
- 1
- Calories
- 520
- Protein
- 22g
casualelegantcalifornianturkeycrispycreamyflakyweeknight
Ingredients
6 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Split the croissant lengthwise and lightly toast the cut sides if desired.
Step 2
Spread mayonnaise on both cut sides of the croissant.
Step 3
Layer turkey, bacon, and fresh greens on the bottom half.
Step 4
Slice the avocado and fan it on top of the greens.
Step 5
Close the croissant and slice diagonally. Serve immediately.
Tools you’ll need
- serrated bread knife
- small spreading knife
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.
