Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Turkey Avocado Club

A classic three-layer club with crispy bacon, sliced turkey, creamy avocado, and fresh tomato on toasted bread. Assemble in minutes for a satisfying lunch or light dinner.

Total time
10 min
Servings
2
Calories
520
Protein
32g
Turkey Avocado Club
casualsatisfyingamericanturkeycrispycreamytenderweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cook bacon in a skillet over medium-high heat until crispy, about 5 minutes. Transfer to a paper towel.

  2. Step 2

    Toast the bread slices until golden and crispy, about 2 minutes per side.

  3. Step 3

    Spread mayonnaise on all six toast slices. Slice the avocado and tomato into thin pieces.

  4. Step 4

    Layer turkey, bacon, and avocado on the first slice. Add tomato on the second slice. Stack and top with the third slice.

  5. Step 5

    Cut the sandwich diagonally into quarters, secure with toothpicks if needed, and serve immediately.

Tools you’ll need

  • skillet
  • paper towels
  • toaster or toaster oven
  • cutting board
  • serrated knife
  • spreader or butter knife
  • toothpicks (optional)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.