Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Turkey Avocado Club with Citrus & Egg

Open-faced turkey, avocado, and crispy bacon on toasted bread, served with fresh oranges, kiwi, and a hard-boiled egg for a complete, colorful plate. No cooking required for the sandwich itself—just assembly and a quick toast.

Total time
15 min
Servings
2
Calories
580
Protein
32g
Turkey Avocado Club with Citrus & Egg
casuallightamericanturkeycrispycreamytenderweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cook bacon in a skillet over medium-high heat until crispy, about 6 minutes. Transfer to a plate.

  2. Step 2

    Toast the bread slices until golden brown and crispy, about 2 minutes per side.

  3. Step 3

    Slice the avocado in half, remove the pit, and scoop onto the toasted bread. Mash gently with a fork.

  4. Step 4

    Layer the sliced turkey and crispy bacon on top of the avocado toast. Season with salt and pepper.

  5. Step 5

    Arrange the sandwich on a plate alongside halved hard-boiled eggs and fresh orange and kiwi slices.

  6. Step 6

    Serve immediately while the toast is still warm.

Tools you’ll need

  • 12-inch skillet
  • toaster or toaster oven
  • knife
  • fork

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.