Back to recipes
Turkey Avocado Sandwich
A classic deli sandwich with tender sliced turkey, creamy avocado, and crisp lettuce on bread. Ready in under 5 minutes—no cooking required.
- Total time
- 5 min
- Servings
- 1
- Calories
- 385
- Protein
- 22g
casualquickamericanturkeycrispycreamytenderweeknight
Ingredients
4 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Slice the avocado in half, remove the pit, and scoop onto one bread slice.
Step 2
Spread the avocado evenly across the bread with the back of a fork.
Step 3
Layer the turkey and lettuce leaves over the avocado.
Step 4
Top with the second bread slice, press gently, and cut in half diagonally.
Step 5
Serve immediately with a side of pickles if desired.
Tools you’ll need
- cutting board
- knife
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.
