Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

10-Min Chocolate Martabak

Crispy, buttery pan-fried pancake stuffed with melted chocolate and crushed peanuts. Ready in minutes with zero oven fuss — pure indulgent snack energy.

Total time
10 min
Servings
2
Calories
520
Protein
12g
10-Min Chocolate Martabak
indulgentquickindonesianvegetarianeggscrispyflakygooey

Ingredients

5 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Whisk flour, eggs, and milk until smooth batter forms with no lumps.

  2. Step 2

    Heat butter in a 10-inch skillet over medium-high until it foams, ~90 seconds.

  3. Step 3

    Pour half the batter into the skillet and swirl to coat the bottom evenly.

  4. Step 4

    Once the bottom is light golden and set, scatter chocolate chips and peanuts over half.

  5. Step 5

    Fold the plain half over the filled half and press gently until chocolate starts to melt.

  6. Step 6

    Flip once and cook until the second side is golden and crispy, ~90 seconds total.

Tools you’ll need

  • 10-inch nonstick skillet
  • whisk
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.