Custrd is out on the App Store — Download it free →
Back to recipes

Baked Fish with Prosciutto and Onions

A quick and flavorful weeknight dinner: tender white fish fillets topped with crispy prosciutto and sweet caramelized onions, all baked together with garlic and lemon. Ready in about 20 minutes with minimal cleanup.

Total time
25 min
Servings
4
Calories
280
Protein
32g
Baked Fish with Prosciutto and Onions
comfortingweeknightItaliangluten-freefishtendercrispyweeknight dinner

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 400°F. Slice 1 large onion thinly and mince 2 garlic cloves. Cut 1 lemon into wedges.

  2. Step 2

    In a 9x13 inch baking dish, toss the sliced onion and minced garlic with 1 tablespoon olive oil. Spread evenly and bake for 5 minutes until slightly softened.

  3. Step 3

    Remove dish from oven. Place 4 fish fillets on top of the onions. Drizzle with remaining 1 tablespoon olive oil and season with salt and pepper.

  4. Step 4

    Lay 4 slices of prosciutto over the fish fillets, tucking edges under. Bake for 12-15 minutes until fish is opaque and flakes easily with a fork.

  5. Step 5

    Serve hot with lemon wedges for squeezing over the top.

Tools you’ll need

  • 9x13 inch baking dish
  • knife
  • cutting board
  • measuring spoons

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.