Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Brown Butter Blondies with Chocolate Chips

Chewy, buttery blondies with nutty brown butter and melted chocolate chips. These bake in 20 minutes and are perfect warm with a glass of milk.

Total time
30 min
Servings
12
Calories
312
Protein
3g
Brown Butter Blondies with Chocolate Chips
comfortindulgentvegetarianchewycrispyweekendcozycookie

Ingredients

9 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Melt butter in a small saucepan over medium heat, swirling occasionally, ~6 minutes.

  2. Step 2

    Continue cooking until the foam subsides and solids turn golden brown and fragrant, ~2 minutes more.

  3. Step 3

    Pour into a bowl, scraping up all the browned bits. Let cool for 5 minutes.

  4. Step 4

    Preheat oven to 350°F. Line an 8x8-inch baking pan with parchment paper.

  5. Step 5

    Whisk cooled brown butter with brown sugar until combined, then beat in the egg and vanilla.

  6. Step 6

    In a separate bowl, whisk together flour, baking powder, salt, and black pepper.

  7. Step 7

    Fold the dry ingredients into the wet mixture until just combined. Fold in chocolate chips.

  8. Step 8

    Spread batter into the prepared pan, smoothing the top.

  9. Step 9

    Bake until golden brown and a toothpick inserted in the center has just a few moist crumbs, 20–22 minutes.

  10. Step 10

    Cool in the pan for 10 minutes, then turn out onto a wire rack to cool completely.

  11. Step 11

    Cut into 12 squares and serve.

Tools you’ll need

  • small saucepan
  • whisk
  • 8x8-inch baking pan
  • parchment paper
  • mixing bowls (2)
  • measuring cups and spoons
  • spatula or wooden spoon
  • wire cooling rack
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.