CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Brown Butter Blondies with Chocolate Chips

Chewy, buttery blondies with nutty brown butter and melted chocolate chips. These bake in 20 minutes and are perfect warm with a glass of milk.

Total time
30 min
Servings
12
Calories
312
Protein
3g
Brown Butter Blondies with Chocolate Chips
comfortindulgentvegetarianchewycrispyweekendcozycookie

Ingredients

  • ¾ cup butter
  • 1.5 cup brown sugar, packed
  • 1 large egg
  • 1 tsp vanilla extract
  • 1.75 cup all-purpose flour
  • ½ tsp baking powder
  • ½ tsp salt
  • 1 cup chocolate chips
  • ⅛ tsp black pepper

Instructions

  1. 1

    Melt butter in a small saucepan over medium heat, swirling occasionally, ~6 minutes.

  2. 2

    Continue cooking until the foam subsides and solids turn golden brown and fragrant, ~2 minutes more.

  3. 3

    Pour into a bowl, scraping up all the browned bits. Let cool for 5 minutes.

  4. 4

    Preheat oven to 350°F. Line an 8x8-inch baking pan with parchment paper.

  5. 5

    Whisk cooled brown butter with brown sugar until combined, then beat in the egg and vanilla.

  6. 6

    In a separate bowl, whisk together flour, baking powder, salt, and black pepper.

  7. 7

    Fold the dry ingredients into the wet mixture until just combined. Fold in chocolate chips.

  8. 8

    Spread batter into the prepared pan, smoothing the top.

  9. 9

    Bake until golden brown and a toothpick inserted in the center has just a few moist crumbs, 20–22 minutes.

  10. 10

    Cool in the pan for 10 minutes, then turn out onto a wire rack to cool completely.

  11. 11

    Cut into 12 squares and serve.

Tools you’ll need

  • small saucepan
  • whisk
  • 8x8-inch baking pan
  • parchment paper
  • mixing bowls (2)
  • measuring cups and spoons
  • spatula or wooden spoon
  • wire cooling rack
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.