Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Cajun Shrimp and Grits

Creamy stone-ground grits topped with spicy, garlicky shrimp in a rich Cajun sauce. A Louisiana classic that tastes restaurant-quality but cooks in under 45 minutes.

Total time
45 min
Servings
4
Calories
520
Protein
38g
Cajun Shrimp and Grits
comfortindulgentcajunshrimpcreamytenderweeknightdate-night

Ingredients

9 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 4 cups chicken broth in a large pot over medium-high until it boils.

  2. Step 2

    Slowly whisk in cornmeal, stirring constantly to prevent lumps, then reduce heat to low.

  3. Step 3

    Stir every 2 minutes for 15 minutes until grits are thick and creamy.

  4. Step 4

    Remove from heat. Stir in 4 tbsp butter and 1 cup cheddar until fully melted.

  5. Step 5

    Heat 2 tbsp olive oil in a large skillet over medium-high until it shimmers.

  6. Step 6

    Add 4 cloves minced garlic and cook, stirring, until fragrant, about 30 seconds.

  7. Step 7

    Add shrimp, 2 tsp Cajun seasoning, and 0.5 tsp smoked paprika. Cook 2 minutes without stirring.

  8. Step 8

    Stir shrimp and cook 1–2 more minutes until pink throughout and just cooked.

  9. Step 9

    Finish with 2 tbsp lemon juice and stir to combine.

  10. Step 10

    Spoon creamy grits into bowls and top with shrimp and pan sauce.

Tools you’ll need

  • large pot
  • whisk
  • wooden spoon
  • 12-inch skillet
  • measuring cups and spoons

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.