CookSnap is in beta — Get it free on TestFlight →
Back to recipes

10-Min Canned Tuna Poke Bowl

Canned tuna mixed with soy sauce and served over warm rice with creamy avocado and crispy wonton chips. A weeknight poke bowl that tastes like takeout, ready in 5 minutes.

Total time
10 min
Servings
2
Calories
385
Protein
28g
10-Min Canned Tuna Poke Bowl
quickfreshasianfishcrispycreamytenderweeknight

Ingredients

  • 2 cups cooked white rice
  • 2 cans (5 oz each) canned tuna in oil, drained
  • 3 tbsp soy sauce
  • 1 large avocado, sliced

Instructions

  1. 1

    Divide warm rice between two bowls, packing it gently to form a base.

  2. 2

    Toss drained tuna with soy sauce until well coated.

  3. 3

    Spoon tuna mixture over the rice in each bowl.

  4. 4

    Arrange avocado slices alongside the tuna.

  5. 5

    Top with wonton chips and taro chips for crunch. Serve immediately.

Tools you’ll need

  • two bowls
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.