Back to recipes
10-Min Canned Tuna Poke Bowl
Canned tuna mixed with soy sauce and served over warm rice with creamy avocado and crispy wonton chips. A weeknight poke bowl that tastes like takeout, ready in 5 minutes.
- Total time
- 10 min
- Servings
- 2
- Calories
- 385
- Protein
- 28g
quickfreshasianfishcrispycreamytenderweeknight
Ingredients
4 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Divide warm rice between two bowls, packing it gently to form a base.
Step 2
Toss drained tuna with soy sauce until well coated.
Step 3
Spoon tuna mixture over the rice in each bowl.
Step 4
Arrange avocado slices alongside the tuna.
Step 5
Top with wonton chips and taro chips for crunch. Serve immediately.
Tools you’ll need
- two bowls
- spoon
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.
