Back to recipes
Cheesy Ravioli with Marinara & Toast
Cheese ravioli boiled until tender, tossed with marinara and topped with parmesan. Toasted bread on the side for dipping. Done in 15 minutes.
- Total time
- 15 min
- Servings
- 2
- Calories
- 380
- Protein
- 16g
comfortquickitalianvegetariancheesetendercreamyweeknight
Ingredients
3 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Bring a large pot of salted water to a boil.
Step 2
Add ravioli and cook until they float and are tender, ~4 minutes.
Step 3
Drain ravioli gently and return to the pot.
Step 4
Pour marinara sauce over ravioli and stir gently to coat.
Step 5
Divide into bowls and top generously with parmesan cheese.
Step 6
Serve immediately with toasted bread alongside.
Tools you’ll need
- large pot
- wooden spoon
- colander
- bowls
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.
