Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Creamy Cajun Crawfish Mac

Tender pasta tossed with a spiced cheese sauce, loaded crawfish, and a hit of hot sauce for that Cajun kick. Ready in under 20 minutes, straight from one skillet to the plate.

Total time
18 min
Servings
4
Calories
720
Protein
38g
Creamy Cajun Crawfish Mac
comfortsatisfyingcajunshrimpcreamytenderweeknightdinner

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil pasta in salted water until al dente, about 8 minutes. Reserve 1 cup pasta water, then drain.

  2. Step 2

    In the same pot, melt butter over medium heat. Add crawfish and stir until fragrant, about 1 minute.

  3. Step 3

    Pour in cream and hot sauce. Stir until it simmers, then reduce heat to low.

  4. Step 4

    Add cheddar slowly, stirring constantly until melted and smooth, about 2 minutes.

  5. Step 5

    Stir in pasta. If sauce is too thick, add reserved pasta water a splash at a time.

  6. Step 6

    Taste and adjust with salt, pepper, and extra hot sauce. Serve hot.

Tools you’ll need

  • large pot
  • wooden spoon
  • measuring spoons
  • measuring cups

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.