Creamy Instant Pot Penne
Penne, marinara, and cream cheese cook together in the Instant Pot for a silky, one-pot dinner in under 15 minutes. No draining or sauce-simmering required—just dump, pressure-cook, and stir.
- Total time
- 12 min
- Servings
- 4
- Calories
- 580
- Protein
- 20g

comfortquickitalianvegetariancreamytenderweeknightpasta
Ingredients
- 1 lb penne pasta
- 24 oz marinara sauce
- 8 oz cream cheese, cubed
Instructions
- 1
Pour 3 cups water into the Instant Pot and set the trivet in place.
- 2
Add penne, marinara sauce, and cream cheese cubes directly into the pot.
- 3
Stir to coat the pasta and break up the cream cheese clumps.
- 4
Close the lid, set to high pressure for 6 minutes, then quick-release.
- 5
Stir again until the cream cheese melts into a silky sauce, ~1 minute.
- 6
Taste, adjust salt and pepper, and serve hot.
Tools you’ll need
- Instant Pot (6-quart or larger)
- wooden spoon
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



