Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Creamy Instant Pot Penne

Penne, marinara, and cream cheese cook together in the Instant Pot for a silky, one-pot dinner in under 15 minutes. No draining or sauce-simmering required—just dump, pressure-cook, and stir.

Total time
12 min
Servings
4
Calories
580
Protein
20g
Creamy Instant Pot Penne
comfortquickitalianvegetariancreamytenderweeknightpasta

Ingredients

3 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pour 3 cups water into the Instant Pot and set the trivet in place.

  2. Step 2

    Add penne, marinara sauce, and cream cheese cubes directly into the pot.

  3. Step 3

    Stir to coat the pasta and break up the cream cheese clumps.

  4. Step 4

    Close the lid, set to high pressure for 6 minutes, then quick-release.

  5. Step 5

    Stir again until the cream cheese melts into a silky sauce, ~1 minute.

  6. Step 6

    Taste, adjust salt and pepper, and serve hot.

Tools you’ll need

  • Instant Pot (6-quart or larger)
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.