Custrd is out on the App Store — Download it free →
Back to recipes

Crispy Butter Mushroom Quesadilla

Tender sautéed mushrooms and melted Monterey Jack folded into a golden, buttery flour tortilla. Five minutes from pan to plate—the weeknight quesadilla that actually tastes restaurant-good.

Total time
10 min
Servings
2
Calories
420
Protein
16g
Crispy Butter Mushroom Quesadilla
quickcomfortmexicanvegetariancrispymeltyweeknightquesadilla

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 1 tbsp butter in a skillet over medium-high until foaming.

  2. Step 2

    Add mushrooms and cook without stirring for 2 minutes until edges brown.

  3. Step 3

    Stir and cook 1 more minute until mushrooms release their liquid and soften.

  4. Step 4

    Spread half the cheese on one tortilla, top with cooked mushrooms and remaining cheese, then fold in half.

  5. Step 5

    Wipe out the skillet and add remaining 1 tbsp butter over medium heat.

  6. Step 6

    Cook the quesadilla 2 minutes per side until golden and cheese melts completely.

Tools you’ll need

  • 10-inch skillet
  • cutting board
  • knife
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.