Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Cheese Phyllo Triangles

Golden, flaky phyllo wrapped around salty feta and ricotta, baked until edges curl and crackle. A 25-minute Greek appetizer that tastes like you spent hours in the kitchen.

Total time
25 min
Servings
4
Calories
280
Protein
9g
Crispy Cheese Phyllo Triangles
crispyelegantgreekvegetariancheesecrispyflakycreamy

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix feta, ricotta, dill, and black pepper in a bowl until combined.

  2. Step 2

    Preheat oven to 400°F. Line a baking sheet with parchment paper.

  3. Step 3

    Lay one phyllo sheet on a cutting board. Brush lightly with melted butter.

  4. Step 4

    Spoon 2 tbsp cheese filling near the bottom-left corner. Fold the phyllo into a triangle, tucking and folding as you go.

  5. Step 5

    Place triangle on the baking sheet, seam-side down. Repeat with remaining phyllo sheets and filling.

  6. Step 6

    Brush each triangle with butter. Bake for 12–15 minutes until golden brown and edges curl.

Tools you’ll need

  • mixing bowl
  • cutting board
  • baking sheet
  • parchment paper
  • pastry brush
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.