Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

15-Min Crispy Feta Pie

Buttery phyllo sheets layered with crumbled feta, herbs, and a touch of honey — ready in 15 minutes. A salty, flaky Greek classic that tastes like you spent hours in the kitchen.

Total time
15 min
Servings
4
Calories
380
Protein
12g
15-Min Crispy Feta Pie
elegantrusticgreekvegetariancheesecrispyflakycreamy

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 400°F. Mix feta, mint, and pepper in a bowl until evenly combined.

  2. Step 2

    Brush a 9-inch baking dish or sheet pan with melted butter, coating the bottom and sides.

  3. Step 3

    Layer 3 phyllo sheets in the dish, brushing each with butter as you stack.

  4. Step 4

    Spread feta mixture evenly over the phyllo, leaving a thin border on all sides.

  5. Step 5

    Layer remaining 3 phyllo sheets on top, brushing each with butter. Tuck edges under slightly.

  6. Step 6

    Bake 8–10 minutes until golden brown and crispy on top. Drizzle with honey and serve hot.

Tools you’ll need

  • 9-inch baking dish or sheet pan
  • medium bowl
  • pastry brush

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.