CookSnap is in beta — Get it free on TestFlight →
Back to recipes

20-Min Crispy Feta Cheese Pie

Buttery phyllo sheets layered with crumbled feta, melted in minutes until the pastry turns golden and shatters. A TikTok-easy take on Greek tyropita that tastes like you spent an hour in the kitchen.

Total time
20 min
Servings
4
Calories
312
Protein
11g
20-Min Crispy Feta Cheese Pie
comfortelegantgreekvegetariancheesecrispyflakycreamy

Ingredients

  • 8 sheets phyllo sheets, thawed
  • 8 oz feta cheese, crumbled
  • ⅓ cup butter, melted
  • 2 tbsp fresh dill (or 1 tsp dried dill)
  • ¼ tsp black pepper

Instructions

  1. 1

    Preheat oven to 400°F. Brush a 9-inch square baking dish with melted butter.

  2. 2

    Mix feta, dill, and black pepper in a small bowl.

  3. 3

    Layer 4 phyllo sheets in the baking dish, brushing each one with melted butter as you lay it down.

  4. 4

    Spread the feta mixture evenly over the phyllo.

  5. 5

    Top with remaining 4 phyllo sheets, brushing each with butter. Brush the final sheet generously.

  6. 6

    Bake for 8–10 minutes until the top is deep golden and you can hear the phyllo crackle.

Tools you’ll need

  • 9-inch square baking dish
  • small mixing bowl
  • pastry brush

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.