Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Crispy Feta Cheese Pie

Buttery phyllo sheets layered with crumbled feta, melted in minutes until the pastry turns golden and shatters. A TikTok-easy take on Greek tyropita that tastes like you spent an hour in the kitchen.

Total time
20 min
Servings
4
Calories
312
Protein
11g
20-Min Crispy Feta Cheese Pie
comfortelegantgreekvegetariancheesecrispyflakycreamy

Ingredients

5 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 400°F. Brush a 9-inch square baking dish with melted butter.

  2. Step 2

    Mix feta, dill, and black pepper in a small bowl.

  3. Step 3

    Layer 4 phyllo sheets in the baking dish, brushing each one with melted butter as you lay it down.

  4. Step 4

    Spread the feta mixture evenly over the phyllo.

  5. Step 5

    Top with remaining 4 phyllo sheets, brushing each with butter. Brush the final sheet generously.

  6. Step 6

    Bake for 8–10 minutes until the top is deep golden and you can hear the phyllo crackle.

Tools you’ll need

  • 9-inch square baking dish
  • small mixing bowl
  • pastry brush

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.