Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Feta & Spinach Pie (Tiropita)

Flaky phyllo wrapped around a warm, creamy feta and spinach filling. Ready in 25 minutes—crisp, salty, and deeply satisfying.

Total time
25 min
Servings
4
Calories
385
Protein
14g
Crispy Feta & Spinach Pie (Tiropita)
comfortrusticgreekvegetariancheesecrispycreamyflaky

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 400°F. Mix spinach, feta, egg, and dill in a bowl until combined.

  2. Step 2

    Layer 4 phyllo sheets in a 8×8-inch baking dish, brushing each lightly with melted butter.

  3. Step 3

    Spread the spinach-feta filling over the phyllo layer in an even layer.

  4. Step 4

    Top with remaining 4 phyllo sheets, brushing each with butter. Score the top into 4 squares with a sharp knife.

  5. Step 5

    Bake until phyllo is golden and crispy, 12–15 minutes. Cool 2 minutes before cutting.

Tools you’ll need

  • 8×8-inch baking dish
  • medium mixing bowl
  • pastry brush
  • sharp knife
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.