Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Feta Pie in 20 Minutes

Phyllo sheets layered with feta, spinach, and dill, brushed with butter and baked until golden and crunchy. A weeknight Greek classic that feels fancy but takes under 20 minutes.

Total time
20 min
Servings
4
Calories
385
Protein
12g
Crispy Feta Pie in 20 Minutes
comfortelegantgreekvegetariancheesecrispyflakycreamy

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 400°F. Mix feta, spinach, dill, and egg in a bowl until combined.

  2. Step 2

    Brush a 9x13-inch baking sheet with melted butter. Lay one phyllo sheet on top.

  3. Step 3

    Brush the phyllo with butter, then repeat: layer 3 more sheets, brushing each with butter.

  4. Step 4

    Spread feta mixture evenly over the phyllo. Top with remaining 4 sheets, brushing each with butter.

  5. Step 5

    Score the top into squares with a sharp knife, making about 8-12 pieces.

  6. Step 6

    Bake until golden brown and crispy, 12-15 minutes. Let rest 2 minutes before serving.

Tools you’ll need

  • 9x13-inch baking sheet
  • small mixing bowl
  • pastry brush
  • sharp knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.