Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Feta & Spinach Phyllo Pie

Buttery phyllo layers stuffed with salty feta, wilted spinach, and a whisper of dill—ready in 25 minutes. Serve with strong black tea for the full Greek experience.

Total time
25 min
Servings
2
Calories
340
Protein
12g
Crispy Feta & Spinach Phyllo Pie
comfortrusticgreekvegetariancheesecrispyflakycreamy

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oven to 400°F. Wilt spinach in a dry skillet over medium-high heat for 2 minutes, stirring constantly until no moisture remains.

  2. Step 2

    Transfer spinach to a bowl and mix with crumbled feta, dill, and black pepper until evenly combined.

  3. Step 3

    Brush a sheet pan with melted butter. Layer 3 phyllo sheets on top, brushing each with butter as you stack.

  4. Step 4

    Spread spinach-feta mixture evenly over the phyllo, leaving a 1-inch border on all sides.

  5. Step 5

    Top with remaining 3 phyllo sheets, brushing each with butter. Brush the final layer generously with remaining butter.

  6. Step 6

    Bake until golden brown and crispy, 12–15 minutes. Cool 3 minutes, cut into 4 pieces, and serve immediately.

Tools you’ll need

  • 12-inch skillet
  • sheet pan
  • small bowl
  • pastry brush
  • kitchen knife
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.