CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Feta & Spinach Phyllo Pie

Buttery phyllo layers stuffed with salty feta, wilted spinach, and a whisper of dill—ready in 25 minutes. Serve with strong black tea for the full Greek experience.

Total time
25 min
Servings
2
Calories
340
Protein
12g
Crispy Feta & Spinach Phyllo Pie
comfortrusticgreekvegetariancheesecrispyflakycreamy

Ingredients

  • 6 sheets phyllo dough
  • 200 g feta cheese, crumbled
  • 150 g fresh spinach, roughly chopped
  • 4 tbsp butter, melted
  • 1 tbsp fresh dill, chopped
  • ¼ tsp black pepper

Instructions

  1. 1

    Heat oven to 400°F. Wilt spinach in a dry skillet over medium-high heat for 2 minutes, stirring constantly until no moisture remains.

  2. 2

    Transfer spinach to a bowl and mix with crumbled feta, dill, and black pepper until evenly combined.

  3. 3

    Brush a sheet pan with melted butter. Layer 3 phyllo sheets on top, brushing each with butter as you stack.

  4. 4

    Spread spinach-feta mixture evenly over the phyllo, leaving a 1-inch border on all sides.

  5. 5

    Top with remaining 3 phyllo sheets, brushing each with butter. Brush the final layer generously with remaining butter.

  6. 6

    Bake until golden brown and crispy, 12–15 minutes. Cool 3 minutes, cut into 4 pieces, and serve immediately.

Tools you’ll need

  • 12-inch skillet
  • sheet pan
  • small bowl
  • pastry brush
  • kitchen knife
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.