Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Mozzarella Margherita Flatbread

Flatbread topped with warm marinara, melted fresh mozzarella, and basil. Toast it until the crust crisps and the cheese bubbles, then finish with a basil shower for a 10-minute dinner.

Total time
10 min
Servings
2
Calories
320
Protein
12g
Crispy Mozzarella Margherita Flatbread
simplecasualitalianvegetariancrispymeltyweeknightflatbread

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat a skillet over medium-high heat until oil shimmers, about 1 minute.

  2. Step 2

    Place flatbread in the skillet and toast 1 minute until the bottom starts to brown.

  3. Step 3

    Spread marinara sauce over the flatbread and top with torn fresh mozzarella.

  4. Step 4

    Cover the skillet and cook 2-3 minutes until cheese melts and edges crisp.

  5. Step 5

    Tear basil leaves over the top and serve hot.

Tools you’ll need

  • 12-inch skillet or larger
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.