Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Pesto Mozzarella Zucchini Sandwich

Thin zucchini slices grilled until golden and piled onto bread with melted mozzarella and pesto. A quick, cheesy, veggie-loaded sandwich that's ready in 15 minutes.

Total time
15 min
Servings
2
Calories
310
Protein
12g
Crispy Pesto Mozzarella Zucchini Sandwich
quicksimpleamericanvegetariancheesecrispymeltyweeknight

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Slice the zucchini lengthwise into 1/4-inch-thick planks.

  2. Step 2

    Heat oil in a skillet over medium-high until shimmering, about 90 seconds.

  3. Step 3

    Pan-fry zucchini 2 minutes per side until golden and tender, working in batches if needed.

  4. Step 4

    Spread pesto on both bread slices, then layer zucchini and mozzarella between them.

  5. Step 5

    Wipe the skillet, return it to medium heat, and pan-fry sandwich 2 minutes per side until bread crisps and cheese melts.

Tools you’ll need

  • cutting board
  • knife
  • 12-inch skillet
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.