Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Spinach & Cheese Fatayer

Flaky Lebanese pastries stuffed with garlicky spinach, onion, and cheese, baked until golden and served with fresh chili peppers and parsley. A 25-minute weeknight dinner that tastes like a beirut bakery.

Total time
25 min
Servings
2
Calories
285
Protein
9g
Crispy Spinach & Cheese Fatayer
comfortcasuallebanesevegetariancheeseflakycrispyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 1 tbsp oil in a large skillet over medium-high. Add onion and cook until translucent, ~2 minutes.

  2. Step 2

    Add spinach in batches, stirring until completely wilted and any liquid has evaporated, ~4 minutes total.

  3. Step 3

    Stir in feta and half the parsley. Season with salt and pepper, then transfer to a bowl to cool slightly.

  4. Step 4

    Preheat oven to 400°F. Brush 3 phyllo sheets with oil, stack them, and cut into 6 equal squares on a baking sheet.

  5. Step 5

    Divide filling among squares, fold two opposite corners to center (triangle shape), brush tops with oil.

  6. Step 6

    Bake until golden and crispy, ~12 minutes. Top with fresh chili slices and remaining parsley. Serve warm.

Tools you’ll need

  • large skillet
  • baking sheet
  • pastry brush

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.