CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Spinach & Cheese Fatayer

Flaky Lebanese pastries stuffed with garlicky spinach, onion, and cheese, baked until golden and served with fresh chili peppers and parsley. A 25-minute weeknight dinner that tastes like a beirut bakery.

Total time
25 min
Servings
2
Calories
285
Protein
9g
Crispy Spinach & Cheese Fatayer
comfortcasuallebanesevegetariancheeseflakycrispyweeknight

Ingredients

  • 6 sheets frozen phyllo dough
  • 3 cups fresh spinach, roughly chopped
  • ½ medium yellow onion, minced
  • ¾ cup feta cheese, crumbled
  • ¼ cup fresh parsley, chopped
  • 2 whole red chili peppers, thinly sliced
  • 3 tbsp olive oil

Instructions

  1. 1

    Heat 1 tbsp oil in a large skillet over medium-high. Add onion and cook until translucent, ~2 minutes.

  2. 2

    Add spinach in batches, stirring until completely wilted and any liquid has evaporated, ~4 minutes total.

  3. 3

    Stir in feta and half the parsley. Season with salt and pepper, then transfer to a bowl to cool slightly.

  4. 4

    Preheat oven to 400°F. Brush 3 phyllo sheets with oil, stack them, and cut into 6 equal squares on a baking sheet.

  5. 5

    Divide filling among squares, fold two opposite corners to center (triangle shape), brush tops with oil.

  6. 6

    Bake until golden and crispy, ~12 minutes. Top with fresh chili slices and remaining parsley. Serve warm.

Tools you’ll need

  • large skillet
  • baking sheet
  • pastry brush

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.