CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Ta'ameya with Fresh Tomato & Pepper Salad

Bright green Egyptian fava bean patties, fried until golden and crackling, served with a snappy chopped tomato and green pepper salad. A weeknight vegetarian dinner that tastes like the streets of Cairo.

Total time
25 min
Servings
2
Calories
285
Protein
14g
Crispy Ta'ameya with Fresh Tomato & Pepper Salad
casualfreshegyptianvegetarianveganchickpeascrispycrunchy

Ingredients

  • 2 cups frozen fava beans, thawed
  • ¾ cup fresh parsley, roughly chopped
  • ¼ cup fresh cilantro, roughly chopped
  • 2 whole green onion, chopped
  • 3 tbsp all-purpose flour
  • 1 cup tomatoes, chopped
  • 1 whole green bell pepper, chopped

Instructions

  1. 1

    Pulse fava beans, parsley, cilantro, and green onion in a food processor until roughly mixed but still textured, about 10 pulses.

  2. 2

    Transfer to a bowl, fold in flour and a pinch of salt and pepper, then refrigerate for 10 minutes.

  3. 3

    Heat 0.5 inch of oil in a skillet over medium-high until a wooden spoon handle sizzles when dipped, about 2 minutes.

  4. 4

    Scoop mixture into rough 2-inch patties and slide into hot oil in batches; fry 2 minutes per side until deep golden and crispy.

  5. 5

    Transfer patties to paper towels to drain while you toss chopped tomatoes and peppers with a pinch of salt and a squeeze of lemon.

  6. 6

    Serve hot patties alongside the fresh salad on the same plate.

Tools you’ll need

  • food processor
  • medium bowl
  • 12-inch skillet
  • wooden spoon or slotted spoon
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.