Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Ta'ameya with Fresh Tomato & Pepper Salad

Bright green Egyptian fava bean patties, fried until golden and crackling, served with a snappy chopped tomato and green pepper salad. A weeknight vegetarian dinner that tastes like the streets of Cairo.

Total time
25 min
Servings
2
Calories
285
Protein
14g
Crispy Ta'ameya with Fresh Tomato & Pepper Salad
casualfreshegyptianvegetarianveganchickpeascrispycrunchy

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pulse fava beans, parsley, cilantro, and green onion in a food processor until roughly mixed but still textured, about 10 pulses.

  2. Step 2

    Transfer to a bowl, fold in flour and a pinch of salt and pepper, then refrigerate for 10 minutes.

  3. Step 3

    Heat 0.5 inch of oil in a skillet over medium-high until a wooden spoon handle sizzles when dipped, about 2 minutes.

  4. Step 4

    Scoop mixture into rough 2-inch patties and slide into hot oil in batches; fry 2 minutes per side until deep golden and crispy.

  5. Step 5

    Transfer patties to paper towels to drain while you toss chopped tomatoes and peppers with a pinch of salt and a squeeze of lemon.

  6. Step 6

    Serve hot patties alongside the fresh salad on the same plate.

Tools you’ll need

  • food processor
  • medium bowl
  • 12-inch skillet
  • wooden spoon or slotted spoon
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.