Custrd is out on the App Store — Download it free →
Back to recipes

Fried Calamari with Vegetables

Crispy golden calamari rings served with tender sautéed vegetables and a bright lemon-parsley finish. A quick, satisfying weeknight dinner that feels special without much fuss.

Total time
30 min
Servings
4
Calories
320
Protein
24g
Fried Calamari with Vegetables
comfortingweeknightmediterraneanpescatarianseafoodcrispytendercasual dinner

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat the 1 lb calamari rings dry with paper towels. In a shallow dish, place the 0.5 cup flour and season with salt and pepper.

  2. Step 2

    Heat 2 tbsp of the olive oil in a large skillet over medium-high. Add the 1 sliced onion, 1 julienned carrot, and 1 julienned zucchini. Cook, stirring, until tender and lightly browned, about 8 minutes. Transfer to a plate.

  3. Step 3

    Dredge the calamari rings in the seasoned flour, shaking off excess. Add the remaining 1 tbsp olive oil to the skillet and heat over medium-high.

  4. Step 4

    Fry the calamari in a single layer, working in batches if needed, until golden and crispy, about 2-3 minutes per side. Do not overcrowd the pan.

  5. Step 5

    Return the vegetables to the skillet with the calamari. Squeeze the juice of the lemon over everything and toss with the 0.25 cup chopped parsley. Serve immediately with extra lemon wedges.

  6. Step 6

    Optional: sprinkle with grated Parmesan or a pinch of chili flakes before serving if you like.

Tools you’ll need

  • large skillet
  • shallow dish
  • paper towels
  • knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.