Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Harissa Fish with Carrots & Dill

Spiced white fish and roasted carrots on one sheet pan, finished with bright harissa and fresh dill. North African heat, Scandinavian freshness, 20 minutes.

Total time
20 min
Servings
2
Calories
285
Protein
32g
Harissa Fish with Carrots & Dill
freshlightmoroccanfishcrispytenderflakyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oven to 425°F. Mix harissa and olive oil on a sheet pan.

  2. Step 2

    Toss carrots in the harissa oil. Spread in a single layer, season with salt and pepper.

  3. Step 3

    Roast carrots for 8 minutes until they start to soften.

  4. Step 4

    Push carrots to the sides. Nestle fish fillets in the center, skin-side up.

  5. Step 5

    Roast 8-10 minutes until fish flakes easily at the thickest point.

  6. Step 6

    Scatter dill over everything. Serve with lemon wedges.

Tools you’ll need

  • sheet pan (18 x 13 inch)
  • small bowl for mixing
  • spoon for stirring

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.