Hummus & Spinach Flatbread
Toasted flatbread topped with creamy hummus, fresh spinach, and roasted bell peppers. A 10-minute Mediterranean lunch that's as pretty as it is easy.
- Total time
- 10 min
- Servings
- 2
- Calories
- 285
- Protein
- 8g

lightsimplemediterraneanvegetarianvegancreamycrispyweeknight
Ingredients
- 2 pieces flatbread (pita or naan)
- ½ cup hummus
- 1 whole bell pepper (red or yellow)
- 1.5 cups (loosely packed) fresh spinach
Instructions
- 1
Toast flatbread in a skillet over medium heat until warm and light golden, ~90 seconds per side.
- 2
Slice bell pepper into thin strips, discarding seeds and white ribs.
- 3
Spread hummus evenly across each warm flatbread, using about 1/4 cup per piece.
- 4
Layer spinach and bell pepper strips over the hummus, pressing gently so they stick.
- 5
Cut flatbread in half and serve warm.
Tools you’ll need
- skillet, 10-inch or larger
- cutting board
- knife
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



