Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Hummus & Spinach Flatbread

Toasted flatbread topped with creamy hummus, fresh spinach, and roasted bell peppers. A 10-minute Mediterranean lunch that's as pretty as it is easy.

Total time
10 min
Servings
2
Calories
285
Protein
8g
Hummus & Spinach Flatbread
lightsimplemediterraneanvegetarianvegancreamycrispyweeknight

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Toast flatbread in a skillet over medium heat until warm and light golden, ~90 seconds per side.

  2. Step 2

    Slice bell pepper into thin strips, discarding seeds and white ribs.

  3. Step 3

    Spread hummus evenly across each warm flatbread, using about 1/4 cup per piece.

  4. Step 4

    Layer spinach and bell pepper strips over the hummus, pressing gently so they stick.

  5. Step 5

    Cut flatbread in half and serve warm.

Tools you’ll need

  • skillet, 10-inch or larger
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.