CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Hummus & Spinach Flatbread

Toasted flatbread topped with creamy hummus, fresh spinach, and roasted bell peppers. A 10-minute Mediterranean lunch that's as pretty as it is easy.

Total time
10 min
Servings
2
Calories
285
Protein
8g
Hummus & Spinach Flatbread
lightsimplemediterraneanvegetarianvegancreamycrispyweeknight

Ingredients

  • 2 pieces flatbread (pita or naan)
  • ½ cup hummus
  • 1 whole bell pepper (red or yellow)
  • 1.5 cups (loosely packed) fresh spinach

Instructions

  1. 1

    Toast flatbread in a skillet over medium heat until warm and light golden, ~90 seconds per side.

  2. 2

    Slice bell pepper into thin strips, discarding seeds and white ribs.

  3. 3

    Spread hummus evenly across each warm flatbread, using about 1/4 cup per piece.

  4. 4

    Layer spinach and bell pepper strips over the hummus, pressing gently so they stick.

  5. 5

    Cut flatbread in half and serve warm.

Tools you’ll need

  • skillet, 10-inch or larger
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.